PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g103820.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 95aa    MW: 10405.7 Da    PI: 7.847
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g103820.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer66.64.6e-211367257
         ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                        ++++Y  ClkNh  + G ++vDGC+Ef+++ g++gt++ + Ca CgC R FHR ++
  Sopim01g103820.0.1 13 MTIKYGICLKNHDTKFGDYSVDGCREFVKK-GDDGTKEEFICANCGCFRGFHRMNS 67
                        5789*************************9.999*******************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-111469IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.3E-221567IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-141665IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152317.7881766IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MASNSSSNSN DDMTIKYGIC LKNHDTKFGD YSVDGCREFV KKGDDGTKEE FICANCGCFR  60
GFHRMNSQSL FRPPILRSCF IHAHVITHGG GHTG*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755131e-156HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010321229.15e-41PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ9LJW54e-15MIF2_ARATH; Mini zinc finger protein 2
TrEMBLK4B1V73e-64K4B1V7_SOLLC; Uncharacterized protein
STRINGSolyc01g103820.1.17e-64(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13748615
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.15e-16mini zinc finger 2